PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_27756
Common NameKK1_028978
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 243aa    MW: 27876.4 Da    PI: 8.0478
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_27756genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.87.7e-16956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+  Ed+ll  +v+q+G g W++++ + g++R++k+c++rw++yl
    C.cajan_27756  9 KGAWSGVEDDLLRACVRQYGEGKWHLVPTRAGLNRCRKSCRLRWLNYL 56
                     799*******************************************97 PP

2Myb_DNA-binding46.21e-1462106147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg + ++E + l++++k+lG++ W++Ia +++ gRt++++k++w++y
    C.cajan_27756  62 RGDFAEDEVDMLLRLHKLLGNR-WSLIAGRLP-GRTPNDVKNYWNTY 106
                      788899****************.*********.************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.966156IPR017930Myb domain
SuperFamilySSF466899.18E-277103IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-20759IPR009057Homeodomain-like
SMARTSM007171.4E-13858IPR001005SANT/Myb domain
PfamPF002492.8E-14956IPR001005SANT/Myb domain
CDDcd001676.78E-91156No hitNo description
PROSITE profilePS5129424.77157111IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2260110IPR009057Homeodomain-like
SMARTSM007176.5E-1561109IPR001005SANT/Myb domain
PfamPF002491.6E-1362106IPR001005SANT/Myb domain
CDDcd001674.52E-1067107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MEGIVCVRKG AWSGVEDDLL RACVRQYGEG KWHLVPTRAG LNRCRKSCRL RWLNYLKPNI  60
KRGDFAEDEV DMLLRLHKLL GNRWSLIAGR LPGRTPNDVK NYWNTYIRRR ACSHKVVSNE  120
KEEEIVKPHE VIRPRARTIS RASPWLRGTS VVREGAESGV KQSSTQACGE ASLSEYNNWW  180
KTMMDDDDKG GNIENSQDGF GRLMEDINNC QENLTSLTSQ GGDFPIEGQN WSDFLLDTNL  240
WDF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-2431111108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003554899.11e-115PREDICTED: transcription factor MYB114
SwissprotQ9FNV98e-56MY113_ARATH; Transcription factor MYB113
TrEMBLA0A151S3600.0A0A151S360_CAJCA; Transcription factor MYB113 family
STRINGGLYMA19G02980.21e-114(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.15e-57myb domain protein 113